>1ij3_C mol:protein length:34  general control protein GCN4
XRMKQLEDKVEELLSKSYHLENEVARLKKLVGER