>1ikm_A mol:protein length:72  HUMAN INTERLEUKIN-8 (MONOMERIC)
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQ
RVVEKFLKRAENS