>1il8_A mol:protein length:72  INTERLEUKIN-8
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQ
RVVEKFLKRAENS