>1iw4_A mol:protein length:55  trypsin inhibitor
AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE
>1iw4_A mol:protein length:55  trypsin inhibitor
AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE