>1izl_Q mol:protein length:44  Photosystem II: Subunit PsbF
TSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR