>1j3r_A mol:protein length:190  Phosphoglucose Isomerase
MKYKEPFGVKLDFETGIIENAKKSVRRLSDMKGYFIDEEAWKKMVEEGDPVVYEVYAIE
QEEKEGDLNFATTVLYPGKVGNEFFMTKGHYHSKIDRAEVYFALKGKGGMLLQTPEGEA
RFIEMEPGTIVYVPPYWAHRTINTGDKPFIFLALYPADAGHDYGTIAEKGFSKIVVEEN
GKVVVKDNPKWRM