>1j75_B mol:na length:7  5'-D(*TP*CP*GP*CP*GP*CP*G)-3'
TCGCGCG
>1j75_A mol:protein length:67  Tumor Stroma and Activated Macrophage Protein DLM-1
GSHMLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPE
PATWSIGG
>1j75_B mol:na length:7  5'-D(*TP*CP*GP*CP*GP*CP*G)-3'
TCGCGCG