>1j75_A mol:protein length:67  Tumor Stroma and Activated Macrophage Protein DLM-1
GSHMLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPE
PATWSIGG