>1jbr_B mol:protein length:149  Restrictocin
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNG
KLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGP
ARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
>1jbr_A mol:protein length:149  Restrictocin
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNG
KLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGP
ARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
>1jbr_C mol:na length:18  5'-R(*GP*CP*GP*CP*UP*CP*CP*UP*CP*AP*GP*UP*AP*CP*GP*AP*GP*(A23))-3'
GCGCUCCUCAGUACGAGA
>1jbr_F mol:na length:13  5'-R(*GP*GP*AP*AP*CP*CP*GP*GP*AP*GP*CP*GP*C)-3'
GGAACCGGAGCGC
>1jbr_D mol:na length:31  31-mer SRD RNA analog
GCGCUCCUCAGUACGAGAGGAACCGGAGCGC
>1jbr_D mol:na length:31  31-mer SRD RNA analog
GCGCUCCUCAGUACGAGAGGAACCGGAGCGC