>1jbr_B mol:protein length:149  Restrictocin
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNG
KLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGP
ARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH