>1jh9_B mol:na length:17  5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T)-3'
AACGAAAACGTTTTCGT
>1jh9_B mol:na length:17  5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T)-3'
AACGAAAACGTTTTCGT
>1jh9_A mol:protein length:340  PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGL
LVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAKADFTDAVIDNAFEGGYMAGRYLIERGH
REIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQP
HRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDS
LGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR