>1jkr_C mol:protein length:52  DNA-INVERTASE HIN
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN