>1jpl_A mol:protein length:171  ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
GAMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKI
QSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTK
VIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKN
>1jpl_E mol:protein length:12  Cation-Independent Mannose 6-phosphate receptor
FHDDSDEDLLHI
>1jpl_C mol:protein length:171  ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
GAMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKI
QSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTK
VIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKN
>1jpl_H mol:protein length:12  Cation-Independent Mannose 6-phosphate receptor
FHDDSDEDLLHI
>1jpl_F mol:protein length:12  Cation-Independent Mannose 6-phosphate receptor
FHDDSDEDLLHI
>1jpl_G mol:protein length:12  Cation-Independent Mannose 6-phosphate receptor
FHDDSDEDLLHI
>1jpl_H mol:protein length:12  Cation-Independent Mannose 6-phosphate receptor
FHDDSDEDLLHI
>1jpl_B mol:protein length:171  ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
GAMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKI
QSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTK
VIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKN
>1jpl_D mol:protein length:171  ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
GAMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKI
QSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTK
VIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKN