>1jqp_A mol:protein length:438  dipeptidyl peptidase I
DTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPTEEKVVIHLKKLDTAYDEVGNSGY
FTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHETMTGWVHDVLGRNWACFVGKKM
ANHSEKVYVNVAHLGGLQEKYSERLYSHHHNFVKAINSVQKSWTATTYRRYEKLSIRDL
IRRSGHSGRILRPKPAPITDEIQQQILSLPESWDWRNVRGINFVSPVRNQESCGSCYSF
ASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEEN
CFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDD
FLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGY
FRIRRGTDECAIESIAMAAIPIPKL