>1jv5_A mol:protein length:107  Ig kappa chain precursor V region
DIQMTQTTSSLSASLGDRVTISCRASQDINNYLNWYQQKPDGTVKLLIHYTSRLHSGVP
SRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIK