>1jwg_A mol:protein length:147  ADP-ribosylation factor binding protein GGA1
MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQ
EWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILEL
LYSWTVGLPEEVKIAEAYQMLKKQGIVKS