>1jzy_M mol:protein length:60  Ribosomal Protein L32
MAKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQVLA
V