>1k34_A mol:protein length:68  Transmembrane glycoprotein GP41
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLAHSLI
EESQNQQEK