>1k6o_A mol:protein length:93  ETS-domain protein ELK-4
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKL
SRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM