>1k9m_1 mol:protein length:73  RIBOSOMAL PROTEIN L37Ae
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGC
YQPETVAGKAVMKA