>1k9m_4 mol:protein length:92  RIBOSOMAL PROTEIN L44E
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGD
KPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE