>1k9m_K mol:protein length:145  RIBOSOMAL PROTEIN L13
MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEK
RVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDG
TSLDRLSNIKFVTLGEISETLGANKTW