>1k9m_M mol:protein length:164  RIBOSOMAL PROTEIN L15
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQE
EAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHEL
TLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE