>1k9m_T mol:protein length:84  RIBOSOMAL PROTEIN L23
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMD
GEKKAVVRLSEDDDAQEVASRIGVF