>1kd1_T mol:protein length:84  RIBOSOMAL PROTEIN L23
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMD
GEKKAVVRLSEDDDAQEVASRIGVF