>1kd1_X mol:protein length:154  RIBOSOMAL PROTEIN L30
MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQ
ETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRL
HPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR