>1kkq_H mol:protein length:19  NUCLEAR RECEPTOR CO-REPRESSOR 2
NMGLEAIIRKALMGKYDQW
>1kkq_E mol:protein length:19  NUCLEAR RECEPTOR CO-REPRESSOR 2
NMGLEAIIRKALMGKYDQW
>1kkq_H mol:protein length:19  NUCLEAR RECEPTOR CO-REPRESSOR 2
NMGLEAIIRKALMGKYDQW
>1kkq_C mol:protein length:269  PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR
TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKL
VANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAI
FAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDIS
LFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ
LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
>1kkq_A mol:protein length:269  PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR
TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKL
VANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAI
FAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDIS
LFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ
LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
>1kkq_B mol:protein length:269  PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR
TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKL
VANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAI
FAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDIS
LFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ
LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
>1kkq_F mol:protein length:19  NUCLEAR RECEPTOR CO-REPRESSOR 2
NMGLEAIIRKALMGKYDQW
>1kkq_G mol:protein length:19  NUCLEAR RECEPTOR CO-REPRESSOR 2
NMGLEAIIRKALMGKYDQW
>1kkq_D mol:protein length:269  PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR
TADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKL
VANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAI
FAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDIS
LFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ
LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY