>1kmf_B mol:protein length:30  Insulin
FVNQHLCGSDLVEALYLVCGERGFFYTKPT