>1kyo_F mol:protein length:74  UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 17 KD PROTEIN
DTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQH
YLDTATAPRLFDKLK