>1kyo_J mol:protein length:127  HEAVY CHAIN (VH) OF FV-FRAGMENT
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNN
YNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTV
TVSSAWRHP