>1kyo_P mol:protein length:185  UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVL
AMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVK
DPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEF
DGDKVIVG