>1l3h_A mol:protein length:65  MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf)
LTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGH
HNCSES
>1l3h_A mol:protein length:65  MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf)
LTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGH
HNCSES