>1l4w_B mol:protein length:25  Acetylcholine receptor protein
EERGWKHWVYYTCCPDTPYLDITEE
>1l4w_A mol:protein length:74  alpha-Bungarotoxin
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTC
CSTDKCNPHPKQRPG
>1l4w_B mol:protein length:25  Acetylcholine receptor protein
EERGWKHWVYYTCCPDTPYLDITEE