>1lc7_A mol:protein length:364  L-Threonine-O-3-Phosphate Decarboxylase
MALFNTAHGGNIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDA
DYFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAMIVTPGFAEYGRALAQS
GCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKS
LNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAM
ARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYPG
RANYLLLRCEREDIDLQRRLLTQRILIRSCANYPGLDSRYYRVAIRSAAQNERLLAALR
NVLTGIAPAD