>1le9_E mol:protein length:274  NUCLEAR FACTOR NF-KAPPA-B P65 SUBUNIT
MAYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISL
VTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQ
TNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAEL
KICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFR
TPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD