>1lik_A mol:protein length:363  adenosine kinase
MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLD
QFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMV
APGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASGALIFYATAYTLTATPKN
ALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNL
VAAEKVALSVANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTV
VVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYGLSQGKTVKQCIMCGNACAQDVIQHVGF
SLSFTSLPC
>1lik_A mol:protein length:363  adenosine kinase
MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLD
QFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMV
APGQSTGTCAVLINEKERTLCTHLGACGSFRIPENWTTFASGALIFYATAYTLTATPKN
ALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNL
VAAEKVALSVANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTV
VVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYGLSQGKTVKQCIMCGNACAQDVIQHVGF
SLSFTSLPC