>1lwu_L mol:protein length:323  Fibrinogen gamma chain
DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRP
CQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQH
RHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTH
RYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPE
RDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDR
WYSLKMTTMKLLPMGRDLSGHGGQQQSK
>1lwu_G mol:protein length:119  Fibrinogen alpha-1 chain
AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQI
LRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLN
R
>1lwu_M mol:protein length:5  Ligand Gly-His-Arg-Pro-NH2
GHRPX
>1lwu_O mol:protein length:5  Ligand Gly-His-Arg-Pro-NH2
GHRPX
>1lwu_P mol:protein length:5  Ligand Gly-His-Arg-Pro-NH2
GHRPX
>1lwu_K mol:protein length:323  Fibrinogen beta chain
SSTHVNAQKEIENRYKEVKIRIESTVAGSLRSMKSVLEHLRAKMQRMEEAIKTQKELCS
APCTVNCRVPVVSGMHCEDIYRNGGRTSEAYYIQPDLFSEPYKVFCDMESHGGGWTVVQ
NRVDGSSNFARDWNTYKAEFGNIAFGNGKSICNIPGEYWLGTKTVHQLTKQHTQQVLFD
MSDWEGSSVYAQYASFRPENEAQGYRLWVEDYSGNAGNALLEGATQLMGDNRTMTIHNG
MQFSTFDRDNDNWNPGDPTKHCSREDAGGWWYNRCHAANPNGRYYWGGIYTKEQADYGT
DDGVVWMNWKGSWYSMRQMAMKLRPKWP
>1lwu_P mol:protein length:5  Ligand Gly-His-Arg-Pro-NH2
GHRPX
>1lwu_J mol:protein length:119  Fibrinogen alpha-1 chain
AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQI
LRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLN
R
>1lwu_D mol:protein length:119  Fibrinogen alpha-1 chain
AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQI
LRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLN
R
>1lwu_N mol:protein length:5  Ligand Gly-His-Arg-Pro-NH2
GHRPX
>1lwu_I mol:protein length:323  Fibrinogen gamma chain
DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRP
CQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQH
RHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTH
RYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPE
RDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDR
WYSLKMTTMKLLPMGRDLSGHGGQQQSK
>1lwu_E mol:protein length:323  Fibrinogen beta chain
SSTHVNAQKEIENRYKEVKIRIESTVAGSLRSMKSVLEHLRAKMQRMEEAIKTQKELCS
APCTVNCRVPVVSGMHCEDIYRNGGRTSEAYYIQPDLFSEPYKVFCDMESHGGGWTVVQ
NRVDGSSNFARDWNTYKAEFGNIAFGNGKSICNIPGEYWLGTKTVHQLTKQHTQQVLFD
MSDWEGSSVYAQYASFRPENEAQGYRLWVEDYSGNAGNALLEGATQLMGDNRTMTIHNG
MQFSTFDRDNDNWNPGDPTKHCSREDAGGWWYNRCHAANPNGRYYWGGIYTKEQADYGT
DDGVVWMNWKGSWYSMRQMAMKLRPKWP
>1lwu_F mol:protein length:323  Fibrinogen gamma chain
DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRP
CQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQH
RHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTH
RYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPE
RDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDR
WYSLKMTTMKLLPMGRDLSGHGGQQQSK
>1lwu_C mol:protein length:323  Fibrinogen gamma chain
DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRP
CQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQH
RHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTH
RYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPE
RDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDR
WYSLKMTTMKLLPMGRDLSGHGGQQQSK
>1lwu_B mol:protein length:323  Fibrinogen beta chain
SSTHVNAQKEIENRYKEVKIRIESTVAGSLRSMKSVLEHLRAKMQRMEEAIKTQKELCS
APCTVNCRVPVVSGMHCEDIYRNGGRTSEAYYIQPDLFSEPYKVFCDMESHGGGWTVVQ
NRVDGSSNFARDWNTYKAEFGNIAFGNGKSICNIPGEYWLGTKTVHQLTKQHTQQVLFD
MSDWEGSSVYAQYASFRPENEAQGYRLWVEDYSGNAGNALLEGATQLMGDNRTMTIHNG
MQFSTFDRDNDNWNPGDPTKHCSREDAGGWWYNRCHAANPNGRYYWGGIYTKEQADYGT
DDGVVWMNWKGSWYSMRQMAMKLRPKWP
>1lwu_A mol:protein length:119  Fibrinogen alpha-1 chain
AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQI
LRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLN
R
>1lwu_H mol:protein length:323  Fibrinogen beta chain
SSTHVNAQKEIENRYKEVKIRIESTVAGSLRSMKSVLEHLRAKMQRMEEAIKTQKELCS
APCTVNCRVPVVSGMHCEDIYRNGGRTSEAYYIQPDLFSEPYKVFCDMESHGGGWTVVQ
NRVDGSSNFARDWNTYKAEFGNIAFGNGKSICNIPGEYWLGTKTVHQLTKQHTQQVLFD
MSDWEGSSVYAQYASFRPENEAQGYRLWVEDYSGNAGNALLEGATQLMGDNRTMTIHNG
MQFSTFDRDNDNWNPGDPTKHCSREDAGGWWYNRCHAANPNGRYYWGGIYTKEQADYGT
DDGVVWMNWKGSWYSMRQMAMKLRPKWP