>1lwu_C mol:protein length:323  Fibrinogen gamma chain
DSGQKTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRP
CQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQH
RHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTH
RYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPE
RDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDR
WYSLKMTTMKLLPMGRDLSGHGGQQQSK