>1lwu_J mol:protein length:119  Fibrinogen alpha-1 chain
AVSDTSGQTLNEHNELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQI
LRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVVVEETLN
R