>1m3c_A mol:protein length:60  Proto-oncogene C-crk
CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
G