>1mf8_A mol:protein length:373  CALMODULIN-DEPENDENT CALCINEURIN A SUBUNIT, ALPHA ISOFORM
AVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNL
LDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALK
ILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFL
CVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRG
CSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDV
YNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICS
DDELGSEEDGFDGATAAAR
>1mf8_D mol:protein length:11  CYCLOSPORIN A
ALLVTAGLVLA
>1mf8_D mol:protein length:11  CYCLOSPORIN A
ALLVTAGLVLA
>1mf8_C mol:protein length:165  PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPG
FMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK
TEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
>1mf8_B mol:protein length:170  CALCINEURIN B SUBUNIT ISOFORM 1
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVI
DIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKM
MVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV