>1mf8_C mol:protein length:165  PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPG
FMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK
TEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE