>1mjo_G mol:na length:19  CONSENSUS DNA OPERATOR DUPLEX WITH THE CENTRAL TA STEP MUTATED TO AT
TTAGACGTCATGACGTCTA
>1mjo_A mol:protein length:104  METHIONINE REPRESSOR
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
>1mjo_C mol:protein length:104  METHIONINE REPRESSOR
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
>1mjo_F mol:na length:19  CONSENSUS DNA OPERATOR DUPLEX WITH THE CENTRAL TA STEP MUTATED TO AT
TTAGACGTCATGACGTCTA
>1mjo_G mol:na length:19  CONSENSUS DNA OPERATOR DUPLEX WITH THE CENTRAL TA STEP MUTATED TO AT
TTAGACGTCATGACGTCTA
>1mjo_B mol:protein length:104  METHIONINE REPRESSOR
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
>1mjo_D mol:protein length:104  METHIONINE REPRESSOR
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY