>1ml0_A mol:protein length:382  M3 Protein
LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNL
HELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEE
TPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQW
PGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCT
AETGMEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVY
VMAAYFDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRV
APTSMPNLVGVSLMLEGQQYRLEYFGDH