>1mmg_A mol:protein length:762  MYOSIN
MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDS
FTFKTSDGQDRQVKKDDANQRNPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTY
SGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLI
TGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNS
SRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSTTERNYHIFYQLLAGATAEEKKA
LHLAGPESFNYLNQSGCVDIKGVSDEDEFKITRQAMDIVGFSQEEQMSIFKIIAGILHL
GNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILAGRDLVAQHLNVEK
SSSSRDALVKALYGRLFLWLVKKINNVLCSERKAYFIGVLDISGFEIFKVNSFEQLCIN
YTNEKLQQFFNHHMFKVEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDE
QSVFPNATDNTLITKLHSHFSKKNAKYEEPRFSKTEFGVTHYAGQVMYEIQDWLEKNKD
PLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFLTVAAQYKEQLASLMATLETTN
PHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEAIRITRKGFPNRIIYADFVKRYYDL
APNVPRDAEDSQKATDAVLKHLNIDPEQFRFGITKIFFRAGQLARIEEARELPN