>1mrw_B mol:protein length:99  POL polyprotein
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQY
DQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>1mrw_A mol:protein length:99  POL polyprotein
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQY
DQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>1mrw_B mol:protein length:99  POL polyprotein
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQY
DQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF