>1mt7_B mol:protein length:99  PROTEASE RETROPEPSIN
PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQY
DQIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF