>1mvw_I mol:protein length:147  SKELETAL MUSCLE MYOSIN II ESSENTIAL; LIGHT CHAIN
SKAAADDFKEAFLLFDRTGDAKITASQVGDIARALGQNPTNAEINKILGNPSKEEMNAA
AITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTE
EEVEELMKGQEDSNGCINYEAFVKHIMSV