>1mvw_J mol:protein length:840  SKELETAL MUSCLE MYOSIN II
DAEMAAFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVHPKQSFVKGTIQSKEGGKVTV
KTEGGETLTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNPKVVLAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAASGEKKKEEQSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLPAERSYHIFYQIMSNKKPE
LIDMLLITTNPYDYHYVSEGEITVPSIDDQEELMATDSAIDILGFSADEKTAIYKLTGA
VMHYGNLKFKQKQREEQAEPDGTEVADKAAYLMGLNSAELLKALCYPRVGVGNEAVTKG
ETVSEVHNSVGALAKAVYEKMFLWMVIRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSF
EQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFS
ILEEECMFPKATDTSFKNKLYDEHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIS
GWLEKNKDPLNETVIGLYQKSSVKTLALLFATYGGEAEGGGGKKGGKKKGSSFQTVSAL
FRENLNKLMANLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGF
PSRVLYADFKQRYRVLNASAIPEGQFMDSKKASEKLLGGGDVDHTQYAFGHTKVFFKAG
LLGLLEEMRDDKLAEIITATQARCRGFLMRVEYRAMVERRESIFCIQYNVRSFMNVKHW
PWMKLFFKIKPLLK