>1mvw_K mol:protein length:145  SKELETAL MUSCLE MYOSIN II REGULATORY; LIGHT CHAIN
FDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINF
TVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTGGGRFTPEEIKNM
WAAFPPDVAGNVDYKNICYVITHGEDA